About Ape-X-Generation
Accountants who implement our CRM report an immediate increase in client engagement, net profit and capacity!
The Petrie Method CRM automates 95% of a high-value process that transitions existing clients and new leads into high-value services where price is never questioned.
It also helps firms automate workflow like reminders to clients who are yet to submit the information required to complete lodgements, saving staff time and enabling the distribution of workflow rather than a stressful work environment before every lodgement deadline.
Expertise
accountancy marketinglead generationreferral marketing strategieswebsite traffic conversionprofessional services marketingmarketing coachesmarketing automationcontent marketing
Services & Expertise
accountancy marketinglead generationreferral marketing strategieswebsite traffic conversionprofessional services marketingmarketing coachesmarketing automationcontent marketingcrm expertiseactivecampaignfyiignitionbusiness consulting & servicesadvertising servicesclient management automation
Technologies
Google Cloud HostingActive CampaignMicroCircleReviewsAttentiveAIRenderProofpoint
Frequently Asked Questions
Where is Ape-X-Generation located?
What services does Ape-X-Generation offer?
How big is Ape-X-Generation?
What industry does Ape-X-Generation specialize in?
How can I contact Ape-X-Generation?
Explore Similar Agencies
11point2
management consulting · Australia
11point2 is an Australia-based entrepreneurship-as-a-service company founded in 2017 and headquartered in Adelaide, South Australia. The company specializes in...
Read more
4Phase Consulting
management consulting · Australia
4Phase Consulting partners with businesses as venture builders, providing fractional C-Suite and domain experts. We specialise in strategic guidance, planning,...
Read more
alacria
management consulting · Australia
At alacria, we unlock the true value of sport and entertainment experiences through data-led, evidence-based strategies that drive real growth. Our team brings...
Read more